LEAKEDGIRLS - The Nude Teen Leaks Board
  • Home
  • Members
  • Team
  • Help
  • Report Content
  • Search
  • Register
  • Login
  • Home
  • Members
  • Help
  • Search
LeakedGirls
Leakedgirls.cc - The hottest Teen Leaks The Leaks Board Spycam and Public Voyeur Voyeur and Spycam Megathread

Attention! New Posting Rules from 04/01/2022 Please read! (March 09, 2022) x

PLEASE NOTE! We have a new Backup Domain in case Leakedgirls.cc is not accessible --- LEAKEDGIRLS.PK --- (August 21, 2023) x


MrTeen - The ultimate Teen Nude Leaks Site

New Backup Domain Leakedgirls.pk

Voyeur and Spycam Megathread
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#941
06-15-2022, 07:44 PM
Hidden Camera Catches Wife Masturbating On Bed Vbaepq

[Image: 285012783_hidden_camera_catches_wife_mas...vbaepq.jpg]

Quote:Hidden Camera Catches Wife Masturbating On Bed Vbaepq.mp4 (2.5 MB)
Running Time: 00:01:26

Click here to download:
Hidden Camera Catches Wife Masturbating On Bed Vbaepq.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#942
06-15-2022, 08:10 PM
My Gorgeous Mom Sunbathing And Masturbating Hidden Cam Vbahvj

[Image: 285048684_my_gorgeous_mom_sunbathing_and...vbahvj.jpg]

Quote:My Gorgeous Mom Sunbathing And Masturbating Hidden Cam Vbahvj.mp4 (2.72 MB)
Running Time: 00:01:00

Click here to download:
My Gorgeous Mom Sunbathing And Masturbating Hidden Cam Vbahvj.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#943
06-15-2022, 08:37 PM
Teengirlcaughtmasturbatingwithadildobyahi Vbakhx

[Image: 285079268_teengirlcaughtmasturbatingwith...vbakhx.jpg]

Quote:Teengirlcaughtmasturbatingwithadildobyahi Vbakhx.mp4 (32.45 MB)
Running Time: 00:13:39

Click here to download:
Teengirlcaughtmasturbatingwithadildobyahi Vbakhx.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#944
06-15-2022, 09:02 PM
Voyeurhiddenspycamerafemalenakedmasturbati Vbakvx

[Image: 285097002_voyeurhiddenspycamerafemalenak...vbakvx.jpg]

Quote:Voyeurhiddenspycamerafemalenakedmasturbati Vbakvx.mp4 (7.74 MB)
Running Time: 00:00:15

Click here to download:
Voyeurhiddenspycamerafemalenakedmasturbati Vbakvx.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#945
06-15-2022, 09:29 PM
More Cute Mom Caught Masturbating Vbahqj

[Image: 285045283_more_cute_mom_caught_masturbating_vbahqj.jpg]

Quote:More Cute Mom Caught Masturbating Vbahqj.mp4 (5.05 MB)
Running Time: 00:02:09

Click here to download:
More Cute Mom Caught Masturbating Vbahqj.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#946
06-15-2022, 09:54 PM
Horny Blonde In The Bathroom Vbagha

[Image: 285031366_horny_blonde_in_the_bathroom_vbagha.jpg]

Quote:Horny Blonde In The Bathroom Vbagha.mp4 (38.77 MB)
Running Time: 00:15:42

Click here to download:
Horny Blonde In The Bathroom Vbagha.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#947
06-15-2022, 10:46 PM
Hidden Cam Teen Masturbation Vbaelf

[Image: 285012016_hidden_cam_teen_masturbation__vbaelf.jpg]

Quote:Hidden Cam Teen Masturbation Vbaelf.mp4 (3.8 MB)
Running Time: 00:02:10

Click here to download:
Hidden Cam Teen Masturbation Vbaelf.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#948
06-15-2022, 11:12 PM
Infra Red Hidden Mast Vbagox

[Image: 285034105_infra_red_hidden_mast_vbagox.jpg]

Quote:Infra Red Hidden Mast Vbagox.mp4 (1.86 MB)
Running Time: 00:01:06

Click here to download:
Infra Red Hidden Mast Vbagox.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#949
06-15-2022, 11:39 PM
Offi Vbaigy

[Image: 285056342_offi_vbaigy.jpg]

Quote:Offi Vbaigy.mp4 (5.75 MB)
Running Time: 00:02:47

Click here to download:
Offi Vbaigy.mp4
Mephistophela
Offline

Posting Freak

Posts: 242,258
Threads: 29,165
Joined: Jul 2020
Reputation: 0
#950
06-16-2022, 12:04 AM
Black Panties Vbabkl

[Image: 284957056_black_panties_vbabkl.jpg]

Quote:Black Panties Vbabkl.mp4 (7.18 MB)
Running Time: 00:03:03

Click here to download:
Black Panties Vbabkl.mp4
« Next Oldest | Next Newest »

Users browsing this thread: 7 Guest(s)
Pages (3638): « Previous 1 … 93 94 95 96 97 … 3638 Next »
Jump to page 



  • View a Printable Version
  • Subscribe to this thread
Forum Jump:


Visit our Main Partner: Mrteen.cc - The Teenlover Board

Linear Mode
Threaded Mode